Tesamorelin API CAS 901758-09-6 Technical Profile

Product Identity and Technical Profile

Product Name: Tesamorelin API

CAS Number: 901758-09-6

Molecular Formula: C221H366N72O67S

Molecular Weight: 5135.86 g/mol (free base)

Description: A synthetic 44-amino-acid peptide analog of human growth hormone-releasing hormone (GHRH) acetate salt, modified with a trans-3-hexenoyl group attached to the N-terminal tyrosine residue to significantly increase stability against DPP-4 enzymatic cleavage.

Technical Information

Parameter	Specification
CAS Number	901758-09-6
Molecular Formula	C221H366N72O67S
Molecular Weight	5135.86 g/mol (free base)
Sequence	YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Appearance/Form	Lyophilized powder
Purity	≥98% (HPLC)
Storage	Store at -20°C (lyophilized) or 2-8°C (reconstituted)

Molecular, Specification and Handling Notes

The molecular structure of Tesamorelin includes a trans-3-hexenoyl group attached to the N-terminal tyrosine residue, enhancing its stability against DPP-4 enzymatic cleavage. This structural modification is crucial for maintaining the peptide's integrity during storage and handling. The lyophilized form should be stored at -20°C to preserve stability, while the reconstituted form is stable at 2-8°C for short-term use. Handling should minimize exposure to moisture and temperature fluctuations to maintain product quality.

Documentation and B2B Supply

Upon inquiry, batch-specific documentation, including Certificates of Analysis (COA), HPLC profiles, and stability data, can be provided. Packaging options and supply conditions are customizable to meet client requirements. For detailed specifications and to place an order, please visit our product page: Tesamorelin API Product Page.

Inquiry

For more information on Tesamorelin API, including quality assurance, manufacturing capabilities, and to submit an inquiry, please visit the following links:

• Quality Assurance
• Manufacturing Capabilities
• Submit an Inquiry

FAQ

1. What is the CAS number of Tesamorelin?

The CAS number for Tesamorelin is 901758-09-6.

2. What is the molecular weight of Tesamorelin?

The molecular weight of Tesamorelin is 5135.86 g/mol (free base).

3. How should Tesamorelin be stored?

Store Tesamorelin at -20°C in its lyophilized form. After reconstitution, it should be stored at 2-8°C for short-term use.

4. What is the purity of Tesamorelin?

The purity of Tesamorelin is ≥98% as determined by HPLC.

5. How can I place an order for Tesamorelin API?

To place an order or for more information, please visit our product page: Tesamorelin API Product Page.